PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G120300.1
Common NameB456_006G120300, LOC105797921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bHLH
Protein Properties Length: 224aa    MW: 25141 Da    PI: 8.4796
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G120300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH482.3e-154698155
                        CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                 HLH  1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                        ++ +hn+ Er RR+ +Ns f+ Lr+llP a   + kK+s  +++ +Av+YI +Lq
  Gorai.006G120300.1 46 KKLNHNASERHRRKTVNSLFSSLRSLLPLA--DQMKKVSIPATVSEAVKYIPELQ 98
                        6789*************************6..49999***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088814.8114597IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.2E-1446112IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.6E-124698IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.96E-1646117IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003536.4E-1151103IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MCALAPFPTP NWPLLNPIGL QLNYIYENNE TLDSVPQASF DPCVVKKLNH NASERHRRKT  60
VNSLFSSLRS LLPLADQMKK VSIPATVSEA VKYIPELQEQ VERLVHKKEE LLLRISQQGG  120
IKRCSDGRCS SSATVSINRL TSDSEVVIQI TLRKDRVQKT QLSEILHILE EQQGLILLNA  180
TSFESFGGMI FYNIHLQVAP KTTYQLRESD IEALRGKLLA LCN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5827963e-67JX582796.1 Gossypium hirsutum clone NBRI_GE15694 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012483248.11e-165PREDICTED: transcription factor ORG2-like isoform X1
TrEMBLA0A0D2SW691e-165A0A0D2SW69_G
STRINGVIT_13s0047g00450.t011e-60(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48228153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.11e-37bHLH family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]